PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03631.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Whirly
Protein Properties Length: 743aa    MW: 80226.6 Da    PI: 10.5989
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03631.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly41.23.2e-13613658146
                        Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerk 46 
                                   s+yk+kaal+ +++ p+f+ ldsg+ k+ ++G +ll++a+a+a r+
  Zmw_sc03631.1.g00100.1.am.mk 613 SIYKGKAALSFDPRPPQFVPLDSGAYKVAKEGCVLLQFAPAVAARH 658
                                   79*****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.559.101.4E-263148IPR023213Chloramphenicol acetyltransferase-like domain
PfamPF024585.4E-1026144IPR003480Transferase
PfamPF024585.5E-13277463IPR003480Transferase
Gene3DG3DSA:3.30.559.103.1E-30304470IPR023213Chloramphenicol acetyltransferase-like domain
Gene3DG3DSA:2.30.31.101.8E-19601658IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544472.43E-15606658IPR009044ssDNA-binding transcriptional regulator
PfamPF085366.7E-12614658IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016747Molecular Functiontransferase activity, transferring acyl groups other than amino-acyl groups
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MSPRVRVLSV THVQPDQATG PPPRDAEHAI KLSLFDTKFV ALPMGQCLFF YEGDDLPPLP  60
SLSRSLRSAL AATLAVFTPL ASKLTSTLPA SSGEVFIDCS SDGVAPGVRF VEAEYAGGDM  120
RRLAADAEHD VATFLQLVPD LPVGKLPASL AGPGLEPPTF DRAVINRHPK AEEVARKFVR  180
VLAPELPKLV PDLPVGKLPA SLAGPGLEPP TFDRAVINRH PKAEESSSTS ANRNSNIAIS  240
SMTTTASHHL LHHRYFHHPQ CRGNRLNAAL TLPEPSPPPP QNGKNQHWTL PVNTFPVPDI  300
TVQRRKTYLL TADEIRSLKQ RISRQSSGGK TEAPTTHAAI ASLIWTSVVR AKNSSKNYAD  360
DDDVYLMFAA DCRSRLRPPP GDAFFGNCVR SCYARATAGQ LRGGGLAHAA AAVRAHQEDG  420
DQLANAGRWI ELYRAFSRER VTQIGASHWF AAHETDFSWG APSRAELVSV FAGSSYRCAG  480
RGTAWGRCPW RLTGGTWTAS RPASCRSCRA RRVSTPPPPS PFGEMPPPPP LFLSLPSPAL  540
MPVHLPKSAQ TVSVASPFPS SRKPALPACS VASPRHSDYF DPRAPPPPPP RGNGYGRPPR  600
NGALDGRVFT SYSIYKGKAA LSFDPRPPQF VPLDSGAYKV AKEGCVLLQF APAVAARHHR  660
AIRPGLRKIK SWRPAEARSS CTILPRCPTR SAAAALTTRV AESYLCHLRR PLPSPTSPLP  720
RPRLSARGRS VSSPLSTRLS PVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A2e-156076593789p24: plant transcriptional regulator PBF-2
1l3a_B2e-156076593789p24: plant transcriptional regulator PBF-2
1l3a_C2e-156076593789p24: plant transcriptional regulator PBF-2
1l3a_D2e-156076593789p24: plant transcriptional regulator PBF-2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP384123